PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G51060.1
Common NameAtSTY1, F24M12.100, SRS1, STY1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SRS
Protein Properties Length: 370aa    MW: 38352.1 Da    PI: 7.5014
Description Lateral root primordium (LRP) protein-related
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G51060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.43.1e-711382862153
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                  +sg++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thv+stWvpaakrrerqqqla+ + +++  + e+ +kr+re+  +++s+l +t+++s++    
  AT3G51060.1 138 GSGGVSCQDCGNQAKKDCSHMRCRTCCKSRGFECSTHVRSTWVPAAKRRERQQQLATVQPQTQLPRGESVPKRHRENLPATSSSLVCTRIPSHS---G 232
                  57899*****************************************************99999999************************9995...7 PP

       DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                  le+ ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd G+ 
  AT3G51060.1 233 LEVGNFPAEVSSSAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDLGPG 286
                  8999************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-64141285IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.7E-27143185IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-26238285IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009851Biological Processauxin biosynthetic process
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000015anatomycotyledon primordium
PO:0000017anatomyvascular leaf primordium
PO:0000018anatomyovule primordium
PO:0000019anatomygynoecium primordium
PO:0004704anatomysepal primordium
PO:0020020anatomynucellus
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGGGNN QEDHRSNTNP PPPVSEAWLW YRNPNVNANA NTNVNANAPS  60
SSNAALGTLE LWQNHNQQEI MFQHQQHQQR LDLYSSAAGL GVGPSNHNQF DISGETSTAG  120
AGRAAAMMMI RSGGSGGGSG GVSCQDCGNQ AKKDCSHMRC RTCCKSRGFE CSTHVRSTWV  180
PAAKRRERQQ QLATVQPQTQ LPRGESVPKR HRENLPATSS SLVCTRIPSH SGLEVGNFPA  240
EVSSSAVFRC VRVSSVEDGE EEFAYQTAVS IGGHIFKGIL YDLGPGSSGG GGYNVVAAGE  300
SSSGGGGAQQ LNLITAGSVT VATASSSTPN LGGIGSSSAA AATYIDPAAL YPTPINTFMA  360
GTQFFPNPRS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402555870.0
Expression AtlasAT3G51060-
AtGenExpressAT3G51060-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the apical parts of the developing gynoecium. Detected throughout the youngest flower primordium. Later relocalizes towards the regions of the presumptive sepal anlagen and remains in sepal primordia until just after their emergence. Also observed on the abaxial side of the young floral meristem. Present in the newly arisen gynoecial primordium. Restricted to the apical parts of the carpels as the open-ended gynoecial cylinder elongates vertically. In the apical regions of the gynoecium, confined to a zone in the interphase between the style and the stigma and fades out later. Within the gynoecium, accumulates in ovule primordia, and, as the ovules developed, restricted to the epidermis of the developing funiculi, to the outer, but not the inner, integuments and to the tip of the nucellus. Also present in the cell layer of the septum that faces the ovary. In the embryo, detected in the cotyledon primordia during late globular to mid heart stage. In addition, transiently expressed in petal and stamen primordia and in the tapetum of the anthers. {ECO:0000269|PubMed:12361963}.
UniprotTISSUE SPECIFICITY: Expressed in flowers, seeds and seedlings. {ECO:0000269|PubMed:12361963}.
Functional Description ? help Back to Top
Source Description
TAIRA member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. STY1/STY2 double mutants showed defective style, stigma as well as serrated leaves. Binds to the promoter of YUC4 and YUC8 (binding site ACTCTAC)
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}.
Function -- GeneRIF ? help Back to Top
  1. STY1 and related genes promote normal development of the style and affect apical-basal patterning of the gynoecium through regulation of auxin homeostasis.
    [PMID: 16740145]
  2. results suggest that reduced auxin concentrations cause the sty1-1 sty2-1 phenotype, that STY1 induces auxin biosynthesis
    [PMID: 18811619]
  3. Induction of the transcriptional activator DORNROSCHEN-LIKE (DRNL) activates the transcription of STY1 and other SHI/STY family members and that this activation is dependent on a functional GCC box.
    [PMID: 21976484]
  4. STY1 induces the transcription of 16 additional genes independently of protein translation.
    [PMID: 22318676]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G51060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G59500(A), AT2G23170(A), AT4G01500(A), AT4G27260(A), AT4G37390(A), AT5G11320(A), AT5G54510(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, gibberellin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G51060
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Gynoecia with aberrant style morphology. The double mutant sty1-1 and sty2-1 has a reduction in the amount of stylar and stigmatic tissues and decreased proliferation of stylar xylem, as well as shorter siliques and rosette and cauline leaves with a higher degree of serration. Hypersensitive to 1-N-naphthylphtalamic acid (NPA), but restored by exogenous application of auxin. {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G51060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0295090.0BT029509.1 Arabidopsis thaliana At3g51060 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190675.40.0protein SHI RELATED SEQUENCE 1
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLR0HK220.0R0HK22_9BRAS; Uncharacterized protein
STRINGAT3G51060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Representative plantOGRP18721140
Publications ? help Back to Top
  1. Fridborg I,Kuusk S,Robertson M,Sundberg E
    The Arabidopsis protein SHI represses gibberellin responses in Arabidopsis and barley.
    Plant Physiol., 2001. 127(3): p. 937-48
    [PMID:11706176]
  2. Kuusk S,Sohlberg JJ,Long JA,Fridborg I,Sundberg E
    STY1 and STY2 promote the formation of apical tissues during Arabidopsis gynoecium development.
    Development, 2002. 129(20): p. 4707-17
    [PMID:12361963]
  3. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  4. Sohlberg JJ, et al.
    STY1 regulates auxin homeostasis and affects apical-basal patterning of the Arabidopsis gynoecium.
    Plant J., 2006. 47(1): p. 112-23
    [PMID:16740145]
  5. Kuusk S,Sohlberg JJ,Magnus Eklund D,Sundberg E
    Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.
    Plant J., 2006. 47(1): p. 99-111
    [PMID:16740146]
  6. Ståldal V,Sohlberg JJ,Eklund DM,Ljung K,Sundberg E
    Auxin can act independently of CRC, LUG, SEU, SPT and STY1 in style development but not apical-basal patterning of the Arabidopsis gynoecium.
    New Phytol., 2008. 180(4): p. 798-808
    [PMID:18811619]
  7. Alvarez JP,Goldshmidt A,Efroni I,Bowman JL,Eshed Y
    The NGATHA distal organ development genes are essential for style specification in Arabidopsis.
    Plant Cell, 2009. 21(5): p. 1373-93
    [PMID:19435933]
  8. Trigueros M, et al.
    The NGATHA genes direct style development in the Arabidopsis gynoecium.
    Plant Cell, 2009. 21(5): p. 1394-409
    [PMID:19435937]
  9. Eklund DM, et al.
    The Arabidopsis thaliana STYLISH1 protein acts as a transcriptional activator regulating auxin biosynthesis.
    Plant Cell, 2010. 22(2): p. 349-63
    [PMID:20154152]
  10. Zawaski C, et al.
    SHORT INTERNODES-like genes regulate shoot growth and xylem proliferation in Populus.
    New Phytol., 2011. 191(3): p. 678-91
    [PMID:21564099]
  11. Eklund DM, et al.
    Expression of Arabidopsis SHORT INTERNODES/STYLISH family genes in auxin biosynthesis zones of aerial organs is dependent on a GCC box-like regulatory element.
    Plant Physiol., 2011. 157(4): p. 2069-80
    [PMID:21976484]
  12. St
    The Arabidopsis thaliana transcriptional activator STYLISH1 regulates genes affecting stamen development, cell expansion and timing of flowering.
    Plant Mol. Biol., 2012. 78(6): p. 545-59
    [PMID:22318676]
  13. Baylis T,Cierlik I,Sundberg E,Mattsson J
    SHORT INTERNODES/STYLISH genes, regulators of auxin biosynthesis, are involved in leaf vein development in Arabidopsis thaliana.
    New Phytol., 2013. 197(3): p. 737-50
    [PMID:23293954]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]